Sermorelin 5mg — Research-Grade GRF(1-29) Amide
Sermorelin is the synthetic 29-residue N-terminal fragment of human growth hormone-releasing hormone, carrying a C-terminal amide. It is commonly designated GRF(1-29)NH2 or hGHRH(1-29)NH2.
Molecula Labs supplies Sermorelin as a high-purity lyophilized peptide for laboratory and research applications. Each batch is independently tested and ships with a matching Certificate of Analysis.
Product Specifications
- CAS Number: 86168-78-7 (free base)
- Molecular Formula: C149H246N44O42S
- Molecular Weight: ~3357.9 g/mol (free base)
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 residues, C-terminal amide)
- Purity: ≥99% (HPLC verified per batch)
- Physical Form: Lyophilized powder
- Storage: Store at -20°C, protect from light and moisture
Supplied as the acetate salt. Acetate content varies by lot, so the molecular weight above is stated for the free base.
Quality Standard
Every vial is produced under controlled conditions and verified by third-party analysis. The Certificate of Analysis for your batch is included with every order.
For laboratory and research use only. Not for human or animal consumption. Not a drug, food, or dietary supplement. Not intended to diagnose, treat, cure, or prevent any disease.
